| Rank |
First Name
|
Last Name
|
Team Name
|
Peptide Name
|
All Methods
|
Amino acid Sequence
|
Synthesize
|
Score
|
Z_activity
|
Z_selectivity
|
EC50 Value on NK2R (nM)
|
EC50 Value on NK1R (nM)
|
EC50, NK1R/EC50, NK2R
|
% of Maximum Activation on NK2R (Peptide (500 μM)/NKA (10 μM))
|
% of Maximum Activation on NC (Peptide (500 μM)/NKA (10 μM))
|
iptm_AB((NK2R_Peptide))
|
iptm AD((NK2R NKA))
|
Chain Iptm
|
chain pair iptm
|
chain pair pae min
|
chain ptm
|
fraction disordered
|
has clash
|
iptm
|
Round
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 831 | Wang | sy | LAB Frontiers | 1 | Custom ensemble/diffusion | MLFYFSPTVYDGSGLGGLGSDYVTSPFYFLM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.11 | [0.49, 0.35, 0.4, 0.08] | [[0.76, 0.67, 0.7, 0.11], [0.67, 0.19, 0.38, 0.01], [0.7, 0.38, 0.65, 0.11], [0.11, 0.01, 0.11, 0.01]] | [[0.76, 1.3, 1.58, 24.86], [1.53, 0.76, 5.6, 24.78], [1.62, 4.99, 0.76, 24.5], [26.58, 30.7, 23.72, 0.77]] | [0.76, 0.19, 0.65, 0.01] | 0.2 | 0 | 0.67 | 2 | ||
| 832 | Wang | sy | LAB Frontiers | 4 | Custom ensemble/diffusion | MLFYFSPTVYDGSGLGCPYTKLNRCCFYFLM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.11 | [0.49, 0.36, 0.39, 0.07] | [[0.75, 0.67, 0.7, 0.11], [0.67, 0.19, 0.39, 0.01], [0.7, 0.39, 0.66, 0.09], [0.11, 0.01, 0.09, 0.01]] | [[0.76, 1.35, 1.53, 25.66], [1.5, 0.76, 5.23, 25.23], [1.62, 4.66, 0.76, 26.09], [23.99, 24.49, 29.77, 0.77]] | [0.75, 0.19, 0.66, 0.01] | 0.2 | 0 | 0.68 | 2 | ||
| 833 | Wei | Dai | OxIDEA | bbbbb | Custom ensemble/diffusion | YPCWYFLM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.43 | [0.6, 0.38, 0.48, 0.24] | [[0.75, 0.67, 0.7, 0.43], [0.67, 0.01, 0.46, 0.0], [0.7, 0.46, 0.66, 0.28], [0.43, 0.0, 0.28, 0.01]] | [[0.76, 5.9, 1.47, 6.79], [6.55, 0.77, 16.06, 10.18], [1.53, 10.25, 0.76, 10.71], [7.49, 11.95, 22.49, 0.76]] | [0.75, 0.01, 0.66, 0.01] | 0.18 | 0 | 0.69 | 2 | ||
| 834 | 仁杰 | 李 | 智药元创医学技术(上海) | 006 | Custom generative | EPYTKLNKCSY | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.91 | [0.76, 0.37, 0.58, 0.52] | [[0.75, 0.67, 0.69, 0.91], [0.67, 0.01, 0.43, 0.03], [0.69, 0.43, 0.65, 0.62], [0.91, 0.03, 0.62, 0.02]] | [[0.76, 2.16, 1.58, 1.31], [3.07, 0.76, 18.73, 4.66], [1.63, 7.33, 0.76, 5.0], [1.57, 3.0, 5.99, 0.76]] | [0.75, 0.01, 0.65, 0.02] | 0.16 | 0 | 0.69 | 2 | ||
| 835 | Honghao | Su | HS_peptide | HS1 | AlphaFold2/3 | QTKAGCYYPIM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.6 | [0.65, 0.37, 0.5, 0.33] | [[0.75, 0.67, 0.69, 0.6], [0.67, 0.01, 0.43, 0.02], [0.69, 0.43, 0.64, 0.37], [0.6, 0.02, 0.37, 0.01]] | [[0.76, 5.65, 1.67, 5.49], [5.63, 0.76, 14.45, 9.03], [1.7, 10.29, 0.76, 10.33], [5.69, 10.45, 19.92, 0.76]] | [0.75, 0.01, 0.64, 0.01] | 0.18 | 0 | 0.68 | 2 | ||
| 836 | Honghao | Su | HS_peptide | HS3 | AlphaFold2/3 | NTKAGCYYPMM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.72 | [0.7, 0.39, 0.56, 0.41] | [[0.75, 0.67, 0.71, 0.72], [0.67, 0.01, 0.46, 0.02], [0.71, 0.46, 0.66, 0.49], [0.72, 0.02, 0.49, 0.02]] | [[0.76, 5.34, 1.4, 3.05], [4.95, 0.76, 14.91, 7.48], [1.46, 9.16, 0.76, 6.65], [3.42, 6.8, 10.98, 0.76]] | [0.75, 0.01, 0.66, 0.02] | 0.16 | 0 | 0.71 | 2 | ||
| 837 | Weijie | Chen | AI-Empowered Peptide Chain Alliance | design-2 | AlphaFold2/3 | MLFYFCCRNLKTYPCGLGSDYVTSPFYFLM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.21 | [0.53, 0.38, 0.43, 0.14] | [[0.76, 0.67, 0.7, 0.21], [0.67, 0.21, 0.44, 0.04], [0.7, 0.44, 0.66, 0.16], [0.21, 0.04, 0.16, 0.01]] | [[0.76, 1.33, 1.54, 18.88], [1.5, 0.76, 5.2, 19.74], [1.56, 4.51, 0.76, 20.59], [18.51, 20.42, 29.62, 0.77]] | [0.76, 0.21, 0.66, 0.01] | 0.2 | 0 | 0.68 | 2 | ||
| 838 | Weijie | Chen | AI-Empowered Peptide Chain Alliance | design-3 | AlphaFold2/3 | MLFYFCCRNLKTYPCGGSGLGSDYVTSPFYFLM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.14 | [0.5, 0.38, 0.43, 0.1] | [[0.75, 0.67, 0.7, 0.14], [0.67, 0.25, 0.46, 0.02], [0.7, 0.46, 0.66, 0.15], [0.14, 0.02, 0.15, 0.01]] | [[0.76, 1.3, 1.55, 22.27], [1.5, 0.76, 5.41, 23.12], [1.57, 4.64, 0.76, 21.99], [24.94, 30.24, 21.93, 0.77]] | [0.75, 0.25, 0.66, 0.01] | 0.19 | 0 | 0.68 | 2 | ||
| 839 | wang | xiang | Hum | nk2r-3 | BindCraft | RPCFYFIM | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.44 | [0.61, 0.38, 0.49, 0.25] | [[0.75, 0.67, 0.71, 0.44], [0.67, 0.02, 0.46, 0.0], [0.71, 0.46, 0.67, 0.3], [0.44, 0.0, 0.3, 0.01]] | [[0.76, 6.32, 1.4, 6.15], [7.34, 0.77, 15.01, 10.77], [1.46, 10.57, 0.76, 9.76], [7.1, 13.16, 22.25, 0.76]] | [0.75, 0.02, 0.67, 0.01] | 0.18 | 0 | 0.7 | 2 | ||
| 840 | Yangrui | Liu | Panda | 5 | Custom generative | YWMEGKRLMG | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.67 | 0.85 | [0.75, 0.51, 0.72, 0.48] | [[0.76, 0.67, 0.71, 0.85], [0.67, 0.02, 0.85, 0.0], [0.71, 0.85, 0.76, 0.59], [0.85, 0.0, 0.59, 0.02]] | [[0.76, 5.44, 1.46, 1.51], [5.37, 0.76, 2.58, 11.7], [1.6, 2.64, 0.76, 4.96], [1.88, 11.46, 6.41, 0.76]] | [0.76, 0.02, 0.76, 0.02] | 0.18 | 0 | 0.72 | 2a |
• Problem: There's a global rise in metabolic diseases. An ideal treatment would both reduce food intake and increase energy expenditure. Current drugs often fail to do both effectively and safely.
• Proposed Target: The Neurokinin-2 Receptor (NK2R, Uniprot ID: P21452) is identified as a promising target because it has a unique dual action:
- Centrally (in the nervous system): It suppresses appetite.
- Peripherally (in body tissues): It increases energy expenditure.
• The Challenge: The body's natural activator for NK2R, Neurokinin A (NKA), cannot be used as a drug for two main reasons:
1.Extremely Short Half-life: It breaks down in the body within minutes.
2.Lack of Selectivity: It activates other receptors (NK1R and NK3R), with NK1R activation leading to serious side effects like CNS disorders, inflammation, and pain.
The main objective is to design highly selective and high-affinity NK2R peptide agonists. The designed molecule should:
• Maximize the benefits of activating NK2R.
• Avoid the side effects from activating other receptors, especially NK1R.
To protect innovation, identical sequences are subject to a first-come, first-served basis. Duplicate submissions are not permitted, and no sequence may match any sequence from the first round.
1) The maximum length of the submitted sequence does not exceed 40 natural amino acids, and the similarity with the natural peptide sequence is < 30%. The natural NKA peptide sequence is: HKTDSFVGLM, and the similarity is calculated using mmseqs2.
2) We will use AlphaFold3 to perform structural predictions on the submitted peptide sequences against the target NK2R and the naturally activating peptide NKA. We will only synthesize and test the top 100 sequences in terms of predicted parameters (ipTM, ipAE, etc.) if the submitted sequences can compete out NKA from the binding pocket. Protein sequences: NK2R, NK1R, Gα
3) The evaluation metric for the first round is activity, specifically EC50[NK2R].
4) The evaluation metrics for the second round include both activity and selectivity. The metric for selectivity is EC50[NK2R]/EC50[NK1R]. When EC50[NK2R] < 100 nM, priority is given to selectivity; when EC50[NK2R] > 100 nM, priority is given to activity. Assuming the EC50[NK2R] of both Sequence A and Sequence B is less than 100 nM, the calculation formula at this stage is: Z[activity] + 2.0 * Z[selectivity], where Z represents the normalized score (based on experimental results of all tested sequences).
5) Please pay special attention: all sequences and data submitted in this competition will be open for sharing and can be used by others free of charge.
2025.08.18-2025.09.30 - Submit the designed peptide sequences of the first round.
2025.10.01-2025.11.14 - Synthesize peptide sequences and test their activity of the first round.
2025.11.15-2025.12.15 - Submit the designed peptide sequences of the second round.
2025.12.16-2026.02.28 - Synthesize peptide sequences and test their activity of the second round.
2026.03 - Announce the final results.
Chinese participants: You can add the official WeChat account (FRCBS-THU) to enter the competition discussion group.
Foreign participants: You can click on the link to enter the Discord group.
Boxue Tian
Jianzhu Ma
Yafei Yuan
Xiangyu Liu
Yigong Shi
Hongwei Wang
Xinquan Wang
Haitao Li